Thursday, September 3, 2020

The Hollow Men Analysis

â€Å"We are the Hollow Men, We are the stuffed men† In this sonnet by T. S. Elliot, he utilizes imagery, blended in with a snappy beat toward the start, moving to a more slow one toward the conclusion to portray how a man’s life for the most part passes by. In the beginning times of a man’s life, he is continually being loaded up with data and characteristics that society considers fundamental and attractive. He will invest no energy harping on the deepest weaknesses that we, as people, all have. He is a Hollow Man. As we make a halfhearted effort of life, we once in a while invest energy in our initial a very long time to mull over and dig into the frailties and feelings, the considerations and sentiments that make us what our identity is. We are content being uninformed to the more profound things; the things that make us consider the more prominent activities of the Universe, and the littler operations of ourselves. We realize those things exist; we basically don’t need to hear them, in light of the fact that, as we’ve all heard at once or another, numbness is delight. â€Å"Eyes I dare not meet in dreams† As we move further into the excursion of life, we start to comprehend that something is absent. We start to go to the acknowledgment that there are things about ourselves we don’t need to know. We are embarrassed that we have gone this long, and have not searched out the more noteworthy importance we innately know is there. We know we’ve fouled up, yet don’t need to confront it. We dread what we will find about ourselves. It is simpler to glance in a mirror and see your appearance similarly just like your appearance, and not think about the individual you see. It is anything but difficult to state â€Å"This individual has light hair, blue eyes, and fair skin. † It is hard to state â€Å"This individual has emotions, convictions, uncertainties, and a more profound importance. â€Å"At the hour when we are Trembling with delicacy Lips that would kiss Form supplications to broken stone. † This refrain speaks to how toward the end, we realize that our lives of energy, where we have failed to help a more noteworthy reason than for our very own so lace and amusement, were inconsequential. We know, perhaps just because, that there was more to living than simply existing. We realize that we are nothing, and that we don't have anything. We realize that we are arriving at the end, and we are happy to successfully shield that end from coming. We implore, and ask, and argue, simply needing an opportunity to have accomplished something really advantageous. â€Å"This is the manner in which the world finishes This is the manner in which the world closures This is the way the world finishes Not with a blast, yet a cry. † When that last end comes, it won't be in some stupendous occasion of tumult and hellfire, It will be a lot of more terrible. It will be an individual disclosure that what you have done didn't make a difference. It will come as a peaceful, inner fight, with no one there to reassure you however yourself. You should confront your existence with another feeling of understanding that solitary accompanies the end.

Tuesday, August 25, 2020

The Anthropology of Latin America and the Caribbean Reflection papers Essay

The Anthropology of Latin America and the Caribbean Reflection papers - Essay Example In the book, The Anthropology of Latin America and the Caribbean, the writer has demonstrated the ascent of ethnicity and ethnic development in the Caribbean area (Harry 120). This in itself isn't new since different locales have additionally recorded such developments. For example, USA detailed racial development during the battle to dispense with racial oppression individuals of color. It was a development dependent on race and not ethnic. The instance of the Caribbean and Latin America depends on both race and ethnicity. A lot of it is brought about by the battle for political force among the political classes. Many accept that triumphant a political decision just as a political office must be upheld with the ethnical solidarity. Along these lines, the creator has delineated the ascent of ethnicity and ethnic developments, which planned for requesting power from those, apparent not to be originating from a similar ethnic. Essentially, the creator has discussed patriotism and sexual orientation, which has to do with personality (132). Caribbean and Latin America picked up freedom from colonialists, yet battling to pick up its character. The districts are battling with various issues just as impact from intrigued states. Along these lines, the areas need to search for their personality through securing on patriotism (135). The way of thinking of patriotism gives a nation its character and opportunity from outside impact. The issue of sex comes in as a result of the women's activist battle to get acknowledgment in the everyday running of the administration. A large portion of the Latin America and Caribbean nations have excluded female people in the turn of events. This brings the battle for ladies acknowledgment. As much as the nations need to get their personality and freedom, ladies ought not be overlooked as they additionally assume a significant job. The circumstance in Latin America and Caribbean isn't not quite the same as the remainder of the creating nations. The vast majority of these nations disregard upon ladies and do

Saturday, August 22, 2020

The Massey Lectures

Correspondence Analysis Project - Essay Example I am not a wealthy understudy. I looked wealthy in light of the fact that while I was holding back to be admitted to my advanced education, I was fortunate enough to have an occupation in a property the executives organization as a secretary. Each excursion I generally went to work and returned to my investigations when it was over . That open door made me to have the option to bear the cost of the greater part of costly staff like garments, my hairdos even the phone . At the point when I went to my talks , I dressed the way that I would going to work. Above all I didn’t pay for my own educational cost, I had a grant. It was extremely difficult to stroll in to a talk room after everyone had sat down. The wealth of what I looked like drew a great deal of consideration. Understudies cheered , offered terrible remarks while I was blindingly strolling to a sit at the back. My heart beat so vigorously and I implored God not to fall or breakdown before I arrived at my seat. When at long last got to my seat, those I should be sitting close to moved away. On the off chance that they didn’t move, they took a gander at me as though there was a major issue with me. I wasn’t more established than any of them, I was beginning to think about whether there was some kind of problem with me. I made it my propensity to have my seat five minutes before addresses. I was consistently the main individual and last individual to leave. That was the point at which I met my closest companion. In the subsequent term, it turned out to be more terrible to such an extent that I didn’t need to address any inquiries. One wrong thing I said they ensured that it frequented me. I adored my examinations and I was energetic about them however the idea of getting up toward the beginning of the day was extreme. Holding my self-control helped me a ton .I disclosed to myself that they would get over it in no

7 Myths About Freelance Writing Online

7 Myths About Freelance Writing Online 7 Myths About Freelance Writing Online 7 Myths About Freelance Writing Online By Ali Hale You need to acquire a touch of additional cash. Or on the other hand youd love to be a distributed author. Or on the other hand youre searching for an energizing and compensating vocation. Whatever your explanation, youve began to consider independent composing on the web. It seems like a blessing from heaven: you could telecommute, whenever of the day (or night), and get great cash for expounding on themes that premium you. But somethings halting you. Youve began trusting one †or more †of these unsafe legends. Today, I need to give you that these legends just arent valid. Theres no motivation to let any of them keep you down. #1: Its past the point where it is possible to bring in cash independent composing on the web All the steady employments are now gone, isn't that so? What's more, bloggings dead at any rate Wrong. The way that enormous numbers individuals are bringing in cash online as independent scholars ought to energize you. Theres a lot of work out there †and as an ever increasing number of organizations understand the significance and the capability of the web, new composing employments are showing up each and every day. Truth be told, presently is an extraordinary time to begin outsourcing. Composing on the web is a developing region, especially as increasingly more print magazines crease, and as the interest for online substance develops. #2: Online composing gigs dont pay just as print ones This is a gross speculation, absent a lot of truth in it. Some print distributions dont pay anything †neighborhood papers and claim to fame magazines regularly depend on volunteers, in view of printing and dispersion costs. In any case, on the web, even minor tasks can bear to pay journalists, since their overheads are so low. Some internet composing gigs pay next to no †however there are others which pay a hundred dollars or more for a short article. Its up to you what employments you take, so you never need to work for a low rate. I would say, web based composing gigs pay very well as far as time spent. They may pay less per word †yet they frequently dont require a similar degree of research and actuality watching that print distributions need. #3: You need specialized information to independent compose on the web This legend puts off many individuals. Theyre persuaded that online independent composing requires specialized abilities like realizing HTML code or being a whizz with various frameworks. Truly, you more likely than not as of now have all the specialized aptitudes you need: Capacity to utilize email (to send articles to a supervisor) Fundamental word-handling aptitudes (for example utilizing Microsoft Word or Open Office) Capacity to utilize web crawlers (for example Google, Yahoo) for inquire about It truly is that basic. Obviously, there are a few gigs where youll be at a favorable position if youre alright with transferring content into your customers programming †for example, WordPress †yet there are a lot of composing occupations which dont require anything nerd past the capacity to make a record and send it by email. #4: You need an English or Journalism major to be an independent author Possibly you studied math or a science, or perhaps you didnt attend a university by any stretch of the imagination. It doesnt matter. Every one of that editors care about is your capacity to compose †regardless of whether you have a degree has no effect to them. In the event that youve considered English, Journalism or a related subject, youll presumably be a sure and quick essayist †which will work well for you. In any case, you can undoubtedly build up your composing aptitudes outside the school world †and scholastic composing looks to some extent like the kind of composing that online gigs will need! #5: Receiving installments is hard. Youll need a bookkeeper and a vendor financial balance This fantasy truly baffles me, since its so obsolete! All you have to get cash online is a PayPal account †pretty much each and every online gig Ive ever had has paid through PayPal. The one gig which didnt, with an online magazine, sent me a check which I just stored straight into my financial balance. Opening a PayPal account takes minutes, and permits you to get cash in a wide range of monetary forms without paying the heavy expense that your bank would charge for a remote exchange. #6: Only individuals living in the US can become effective independent journalists Im living evidence this is false †I live in the UK, and have worked with editors in the US, in Canada and in Australia. I am aware of numerous fruitful independent essayists around the globe. Most online gigs will take journalists from anyplace. The only thing that is in any way important is that you can compose great English. On the off chance that you live in a nation with a minimal effort of living, at that point youre really at a bit of leeway †as youll be getting paid US rates for your work. #7: You should be a specialist in one field before you can secure independent positions You as of now have certain zones where youre proficient, just from your background. For example, you may have youngsters †and there are scores of employments searching for individuals who can expound on child rearing. Numerous online gigs are available to any journalists, and dont require a specific aptitude. You may need to do additional exploration in any case, yet on the off chance that you continue composing on comparable subjects, youll before long become a self-educated master. So †seven fantasies busted! I trust youre feeling increasingly idealistic about your own odds of outsourcing on the web. Composing is an extraordinary method to get by (or simply make some additional money as an afterthought) and theres continually going to be an interest for good journalists and new substance. Notice: Due to famous solicitation we have at long last discharged our Freelance Writing Course. Come look at it on the off chance that you need to begin independent composing on the web. Need to improve your English in a short time a day? Get a membership and begin getting our composing tips and activities day by day! Continue learning! Peruse the Freelance Writing classification, check our mainstream posts, or pick a related post below:Creative Writing 10130 Baseball IdiomsOne L or Two?

Friday, August 21, 2020

Scholarly vs Pop Media Focus on Sexuality Essay Example for Free

Insightful versus Pop Media Focus on Sexuality Essay Premature birth is the end of human pregnancy. As indicated by Greenberg, Bruess Conklin there are two sorts of premature birth, Spontaneous premature births, and actuated fetus removal. The regular end of a pregnancy is called unconstrained premature birth or typically called unsuccessful labors, and it happens when the embryo quit creating and its expulse from the utero. Premature births expecting mediation to end the pregnancy are actually called Induce Abortion. Prompt fetus removal has different techniques including Vacuum goal, manual vacuum desire, clinical premature birth, or enlargement and departure. Vacuum yearning is the most well-known fetus removal in the United States, and is a â€Å"surgical system that utilizes a pull cylinder to clear the substance of the uterus, which can be utilized through the principal weeks and the second trimester† (Greenberg, Bruess Conklin, 2010). The manual vacuum desire (MVA) is a variety of vacuum goal that can be utilized from the location of pregnancy as long as 12 weeks since the last menstrual period. (Greenberg, Bruess Conklin, 2010). The clinical fetus removal is the utilized of medication to incite the premature birth. Enlargement and clearing happens during the second trimester of pregnancy. This sort of instigates premature birth â€Å"involves widening the cervix, scratching the mass of the uterus and expelling the endometrial fixing with suction† (Greenberg, Bruess Conklin, 2010). â€Å"Should Parental Involvement Be Required for Minors Abortions? † by Hyman Rodman. In 1973, the U. S Supreme Court gave established approval to women’s’ right to premature birth after Roe versus Swim case. â€Å"The reason for the Courts choice was a womans right to protection: This privilege of security, regardless of whether it be established in the Fourteenth Amendments idea of individual freedom and limitations upon state activity, as we feel it may be, or, as the District Court decided, in the Ninth Amendments reservation of rights to the individuals, is expansive enough to include a womans choice whether to end her pregnancy (Rodman, 1991). One of the significant limitation were banter in the U. S. Supreme Court with respect to the ladies right to a fetus removal was whether to required parental association for minors’ premature births. There are many explanation of why parental contribution ought not be legitimately important. Since fetus removal right to ladies was go in 1973, numerous endeavors have been made to end the privilege to premature birth, to make fetus removal illicit, kill Medicaid assets to pay for premature births, all endeavors have fizzled in light of the fact that â€Å"district courts administered them unsontitutional and as these choices were maintained by the U. S. Incomparable Court Roadman 1991) The discussions of fetus removal still a questionable in two levels, state and national. At the state level governing bodies are attempting to order or confine premature births for reasons of sex determination, except for sparing the mother’s life, forbidding premature births after certain phase of the baby, the utilized of Medicaid or government assets to pay fetus removal, however the most dubious inquiries has to do with underage premature births, and especially with whether to pass laws f or underage authorization or parental agree to have a premature birth. The Court announced a minors right to a premature birth, however it change from state to state. The states choice on parental assent or contribution in minors’ fetus removal is a troublesome undertaking for the state in light of the state courts need to adjust the sacred right of parental and minor’s rights. The States may or not require the contribution or assent of one or the two guardians. On the off chance that the minor wouldn't like to have her parents’ contribution the minor can dodge by heading off to the court. There are numerous reasons of why parent ought to and ought not be include in minors choice on having a premature birth. Rodman express that â€Å"There is a master life contention that parental association will assist youngsters with making a superior and increasingly educated choice about an undesirable pregnancy, and that this will improve the strength of teenagers† (rodman, 1991) There are three reasons of why guardians ought not be include in minors choice on having a premature birth that Rodman present in this article, the first is intentional contribution, there is proof that acceptable parent-kid correspondence about sexual issues prompts progressively dependable sexual conduct by youths. Be that as it may, when correspondence is constrained it is bound to be threatening and non strong. The subsequent explanation is on the grounds that â€Å"Bureaucratic Excess† when the minor maintain a strategic distance from parental inclusion with legal detour. â€Å"Judicial sidestep includes building up court strategies so minors can practice their privilege of protection on the off chance that they need to get a premature birth without parental assent or notification† (Rodman, 1991). Furthermore, the third explanation is â€Å"uniqueness of that choice undoubtedly a one of a kind status applies to conceptive wellbeing choices for the most part, in light of the fact that the courts have perceived that regenerative wellbeing choices are one of a kind in their direness, significance, and sensitivity† (Rodman, 1991). Rodman express that If administrators and policymakers would recognize that, they would desert their endeavors to require parental inclusion in premature birth choices and give a lot more noteworthy thoughtfulness regarding offering help for essential projects in instruction and open government assistance that would diminish destitution, increment openings, improve parent-kid correspondence, and dispose of a large number of the unintended pregnancies that make an interest for minors premature births â€Å"Parental Involvement Laws and their impact on Abortion-Minded † by Robert Schwarzwalder. As per the Centers for Disease Control and Prevention (CDC), the quantity of fetus removal has diminished since 1990 by 20% and it’s because of the parental contribution laws. Michael News 2008 Family Research Council study found that parental contribution laws inside the different states have had a constructive outcome in decreasing the measure of premature births in underage populace. The Supreme Court permitted the states to make laws for minors to increase parental notice or agree to have premature births. In any case, the Supreme Court necessitated that the states to have Parental Involvement laws must have a legal. By 2008, 36 states had received Parental Involvement law with a positive outcomes, the outcomes are that the among of fetus removal in minors (between 1985-1999) have drop by just about 50 % in agreement of the states that parental Involvement isn't required, the pace of premature birth in minors drop just by 13. 4%. Additionally, laws that require the two guardians contribution lessens the in-state premature birth pace of minors by about 31%† (Schwarzwalder, 2008) This examination bolster that the states that help and establish the parental association law or required parental assent has an impact in the quantity of fetus removal by minors. What's more, the impact is a positive, the decay of premature birth of minors. The two guardians contribution diminish the minors’ premature birth rate significantly more. Schwarzwalder’s finding recommends that sta te and government enactment to â€Å"mandates parental association in premature births for minors causes a general decrease in the fetus removal rate among minors. The two articles: â€Å"Should Parental Involvement Be Required for Minors Abortions? † by Hyman Rodman and â€Å"Parental Involvement Laws and their impact on Abortion-Minded † by Robert Schwarzwalder allude to the ROE versus WAVE case result in 1973, the ladies right to fetus removal. Rodman and Schwarzwalder clarify in their article the detour and it techniques, and the two writers talk about the noteworthy impact of parental contribution in minors during the choice of fetus removal. Rodman clarified why guardians ought to or ought not be a piece of minors’ choice toward fetus removal. Rodman and Schwarzwalder concur that when guardians are include in their kids (minors) sexual wellbeing the results positive, Rodman said that â€Å"parental association will assist adolescents with making a superior and progressively educated choice about an undesirable pregnancy, and that this will improve the strength of teenagers† (Rodman, 1991) and Schwarzwalder the declined of fetus removal in minors. Rodman clarifies why guardians ought to or ought to be a piece of minors’ rights in premature birth, he doesn't agree with a particular position or either should guardians be included or not. Rodman end in his article is that the â€Å"legislators and policymakers should concentrate on offer help for essential projects in training and open government assistance that would lessen destitution, increment openings, improve parent-youngster correspondence, and dispense with a large number of the unintended pregnancies that make an interest for minors abortions† (Rodman, 1991) rather than choosing either guardians inclusion in premature birth in underage. Schwarzwalder close his article by expressed that parental assent decrease the quantity of minors’ premature birth rate contrast with the states that don't required parental assent or information. As opposed to Rodman, Schwarzwalder simply give the result of parental association in minors fetus removal yet he neglect to give detail and the explanation of why and how parental contribution help to the positive result on diminishing the quantity of premature birth. Indeed, even thou the two articles were acceptable wellspring of data for my examination, I discover that the best wellspring of data was the companion audit since peer survey is the assessment of work by others in a similar field so as to keep up or improve the nature of the work in a similar field. An essential contrast between peer audit and mainstream media is that the friend survey must be favoring by perceived specialist in the field, read and assessed before the article is submitted for production. Friend audit will be distributed (affirmed) send it backs to creator to be reexamined or dismissed in the event that it doesn't fulfill the discipline’s guidelines of skill. In peer survey diary the creator are by and large Experts (researcher, teacher and so forth ), notes usu

Tuesday, August 4, 2020

Startup Hubs Around the World Sydney

Startup Hubs Around the World Sydney The City of Lights. The Land Down Under. The Outback. Sydney, Australia is located on a continent of intrigue and wonder. For over two hundred years, the city has been establishing itself as a leader in culture and diversity, and has aspirations of becoming one of the world’s top startup hubs.There is a long history of entrepreneurship in Sydney; from its earliest beginnings it has been the home of individuals who seek to change the way things are done. This tradition has continued into today and can be seen in the listing of companies who call Sydney home. © Shutterstock.com | Dan BreckwoldtTo discover what makes Sydney attractive to entrepreneurs, we’ll explore 1) the location, 2) the tax incentives, 3) legal incentives, 4) investors, 5) local resources, 6) specialization of the area, and 7) startups to watch.LOCATIONAs one of the world’s premier tourist destinations, Sydney has a rich and varied culture that appeals to entrepreneurs.Geographical BenefitsLocated on the south-eastern side of Australia, Sydney surrounds one of the world’s largest natural harbors. The natural beauty of the city, along with its historical and cultural attractions, has drawn people to the city since the late 1800’s, and the metropolis continues to thrive.For the entrepreneur who is concerned about transportation, Sydney has amassed a system of transport that is one of the world’s most efficient and useful. With its coastal location, the city is a port city with several shipping ports and cruise terminals along the city’s edge. However, the mai n form of transportation within the city is the motor vehicle. Extensive highways and roads allow for access to all parts of the city, and major highways serve to connect Sydney with the rest of Australia. Public transportation services are provided through trains, ferries and bus transits, efficiently covering Sydney with Australia’s largest public transportation system. There is one international airport that services the city, although plans are underway to add an additional airport in the future.Advantages of choosing the citySydney is one of the most multicultural cities in the world: with a population of over 4 million people, the city is a cross-section of nationalities, representing over a dozen countries and over 200 different languages. Visitors to the city are often amazed at the diversity encountered in the city. For the entrepreneur, this diversity means a broader scope of perspective that enhances the work of the startup. The attractiveness of Sydney to a variety of cultures ensures that skilled workers in a broad range of fields will be comfortable living and working in the city.The city is home an impressive number of cultural offerings including the Sydney Opera House, the Botanical Gardens, the Sydney Tower and a host of sporting teams. Extra-curricular activities are an essential part of the livability of a city, and Sydney is rich with opportunities for rest and relaxation. Nestled among the homes and businesses are an array of green spaces: several national parks (including the second oldest park in the world), gardens, local parks and open spaces. The city is full of opportunities to enjoy the natural beauty of the area.TAX INCENTIVESWhen establishing a startup, one of the important features to consider is the financial and legal ramifications and incentives. Can Sydney support the economic needs of an entrepreneur and create a locale where innovation and design are championed?There are several incentives that the government can offer t o increase the attraction of a city. One such incentive is in the area of employee payroll and benefits. For an entrepreneur, there is often a limited amount of funding, but high hopes for future success. Traditionally, then, the startup offers ‘employee shares’ in the company. Consider a company that needs highly technical employees. They offer their employees an annual salary of $50,000, in conjunction with $50,000 in employee shares. These shares are an attractive lure to designers and developers, and help to encourage longevity and loyalty to the startup. However, recent regulations in Australia have changed the way employee shares are taxed, creating a situation where the employee share has become virtually unusable.At present, employee shares are taxed immediately, creating an expensive and lackluster incentive to the startup that needs employees. Many countries tax shares when there is a financial benefit; for the startup this could be five to ten years down the road. Ins tead, Australia places the tax at the moment that startups are most in need of funds and employees â€" making it less likely that the company will seek personnel in Sydney.New research and development tax incentives are helping to generate a growing tech market in Sydney. The guidelines for this tax incentive provides for substantial tax relief for companies in the research and development sector â€" which can cover anything from gaming solutions to preschool development software. Providing these incentives can help to level the playing field for the startup just venturing into their first few years of business, and can be a large motivating tool for entrepreneurs considering working in this market.By continuing to increase the number of tax incentives for startups, Sydney’s appeal to entrepreneurs will continue to grow. In recent years, the number of Sydney entrepreneurs who are leaving Australia for other, more welcoming startup markets has become large enough to cause concern. This ‘brain drain’ should be alarming to the government of Australia who claims to be interested in the growth of startups. Finding ways to encourage young startup entrepreneurs to stay in Sydney is imperative if the country wishes to continue to develop innovative design and economic growth.LEGAL INCENTIVESA recent upgrade to the Australian Department of Industry has streamlined the process of opening a business in Australia. The new method allows for a consolidated and convenient network that eliminates red tape and makes the startup process easier.The noticeable absence of a startup hub zone is a disadvantage to the city of Sydney â€" the startups are scattered abroad through the city, with no unifying space. The creation of a centralized zone would improve the attraction of the city, in addition to providing for the resources and support that entrepreneurs need to flourish. The addition of legal incentives such as relaxed zoning requirements, improved filing processes and as sistance in gaining investors would all help to establish Sydney as a startup leader.INVESTORSPerhaps one of the most notable reasons entrepreneurs in Sydney give for establishing their company elsewhere is the availability of funding. Startups seeking funding within Sydney may obtain funding from four to five investors, and still not match the amount of funding they’d receive in Silicon Valley from one investor. By sheer size alone, the country is at a relative disadvantage over larger countries that have numbers on their side: a larger population provides a greater number of potential investors. This does not mean that funds are not available, nor does it mean that investors are unavailable in Sydney. It simply means that the entrepreneur who wishes to establish in Sydney must know where to look for the funding they need.In 2012, Australia’s investor opportunities were made up of twelve incubators, 500 angel investors and ten angel groups. With a limited amount of funding avai lable for the early stages of a startup lifestyle, there is a high amount of competition. The most common funding is done through angel investors or Micro-Venture Capital funds. While there is no direct correlation between the amount of funding available and the success of startup companies, there is a relationship between the continued growth of an area’s entrepreneurship and the number of potential investors. As more investors fund successful ventures, it attracts the attention of other investors, which attracts other entrepreneurs, and the cycle of growth continues. The relatively low number of investors in Sydney, while not responsible for the startup culture, does contribute to the lower level of enthusiasm and involvement of entrepreneurs.In addition to seeking investors, there are a number of grants available to entrepreneurs, especially in the early, startup phase. The downside to grant funding is the immense amount of paperwork, qualifications and logistics involved in ob taining (and keeping) the money. Startups are generally hampered by limited employees who are focused on developing their product and do not have the time or experience to wade through the necessary paperwork. Streamlining the process or creating a class of grants specifically that takes into account the early stages of startups is another area that the government of Sydney could improve upon. Recent budget cuts have reduced the number of grants available, making this funding opportunity even more difficult to obtain and frustrating entrepreneurs who most need the assistance.What Is Life Like As An Internet Entrepreneur In Sydney With Aurelius And Justin LOCAL RESOURCESWithin the city of Sydney is a network of resources that can assist the entrepreneur in their reach for startup success.SydStart is one of Sydney’s premier startup organizations, offering support, resources and community for local entrepreneurs. Hosting an annual startup conference in Sydney, SydStart’s recent gat hering brought together 1,000 entrepreneurs, developers and innovators to collaborate and learn. Specialized meetups, workshops and coworking opportunities can offer the startup entrepreneur valuable support at every stage of growth.Startup Smart is a resource specifically designed for the startup community. It offers news, resources and advice for the entrepreneur based in Australia. A valuable tool for the startup company, it can provide connections through meetups, trainings and networks that the startup community needs to remain innovative and relevant.Innovation Bay, Aurelius Digital and Blackbird Ventures are all investment funds based out of Australia. These firms, mostly managed by home-grown entrepreneurs, understand the Australia market and have reached success in their own companies. In an effort to bolster the growing startup culture, they have begun to invest into the companies in the Australian markets â€" many of whom are based in Sydney.Entrepreneurs who are looking to hire trained developers and designers benefit from the number of colleges and universities in Sydney. Engineers, developers and coders are in short supply, so the startup firms in the city are looking towards the universities to provide the necessary manpower. Specialized training, business classes that are geared towards entrepreneurs and other educational resources are all imperative for the startup market in Sydney.SPECIALIZATIONThe startup market in Sydney is wide, with little specialization. Primarily due to the recent surge of entrepreneurship, there is no clear leader among the types of startups; popular meetups vary from agricultural to fashion.The tech market is continuing to grow as the global marketplace changes. The explosive growth of the internet has allowed for immense growth in the area of ecommerce. With mobile development growing at an astronomical rate, entrepreneurs are taking advantage of the challenges the world faces and developing new technologies.Startups that focus on technologies such as e-commerce payment options, personal finance applications, security and mobile applications are all areas that entrepreneurs can hone in on.A concern about the startup market in Sydney is the lack of influence the startups have on the market outside of Australia. Essentially surrounded by water, Sydney is at heart a beach town. The laidback, relaxed attitude and atmosphere that a beach town generally possess is evident in the Sydney lifestyle. Many people attribute the lack of scaled startups coming out of Sydney to this mentality.A relatively recent approach to entrepreneurship in Sydney is the dual-location headquarters. Frequently you will find that entrepreneurs are maintaining offices in Sydney, as well as another startup location around the world. Typically, the secondary location is Silicon Valley, but there are other locations that have shared headquarter locations. The purpose of the dual office is two-fold: location and money. Beginning a new corporation can be overwhelming. Trying to manage a new company while adjusting to a new location can be excruciatingly difficult.By maintain their main headquarters in Sydney, entrepreneurs can take advantage of the benefits of location: easy accessibility to family and friends for funding, support and assistance as needed and a known environment is easier to navigate. Establishing a secondary office in a different location provides the access to funding and outside perspective that the entrepreneur can also use.Kinderloop is an example of this type of startup strategy. Kinderwood offers parents and daycare providers with a secure method of communicating via the internet. The simplified Instagram-like program gives teachers and caregivers the ability to post pictures, videos and class information on a secured network. Parents receive instant notification; schools have a detailed history of parent communication. With an office in Sydney, Kinderloop sought seed funding, and acq uired angel investor funding to propel them to the next startup level. The company then established offices in Silicon Valley to seed additional funding and developers. This global approach to startups allows the entrepreneur to avoid the heavy taxes associated with hiring employees in Sydney, and gives access to the wider funding range of Silicon Valley. So far, this approach has been working â€" more and more companies are beginning to maximize the benefit of holding dual entrepreneurship citizenship.STARTUPS TO WATCHBigCommerce: An e-commerce platform, BigCommerce creates online stores, helps companies build their brand and market their services for a flat $25 monthly fee. Remarkably, they will have a company ready for their first e-commerce sale within 48 hours â€" and have done so for over 40,000 customers since they began.Atlassian: Designed for software designers, Atlassian offers innovators the tools they need to design, build and launch software. Specifically geared towards the teams that develop software, they have provided their services for companies such as Facebook, NASA, Netflix and eBay.FoodOrbit: Enabling chefs and restaurants to buy and sell locally sourced food, Food Orbit helps provide fresher, environmentally friendly food sources.BubbleGum Interactive: An independent game developer, BubbleGum Interactive provides mobile and gaming solutions across multiple platforms.

Monday, June 22, 2020

Scarlet OHara Symbol of the Delusional South - Literature Essay Samples

Gone with the Wind opens with a grandiose description of the South: according to the opening text, this is the region where â€Å"gallantry took its last bow† and â€Å"knights and their ladies† took a stand against the onslaught of Northern aggression. This terminology tries to tie the genteel South depicted in the film to the ideals and perception of the chivalric medieval times. This tie is appropriate, as both times have been misrepresented historically; that is, many romanticize the medieval era of European history and the antebellum era of American history. For them, it is easier (or less painful) to see the beautiful damsels and the gallant knights in shining armor—the equivalent of the belles and the plantation owners—than to see the serfs and lower classes struggling to build a castle or tend a field, just as slaves kept plantations and tended crops. The mechanism by which these time periods were established and maintained—i.e. slave laborà ¢â‚¬â€is overshadowed to the point of nonexistence by the spectacle of the settings and characters associated with those periods. Gone with the Wind gives viewers a distracting visual stimulus—what Tom Brown, quoting Laura Mulvey, calls †to-be-looked-at-ness†Ã¢â‚¬â€in its over-the-top sets and costumes, but it also presents the character of Scarlett O’Hara as an object to be observed. The irony here is that, through various actions, Scarlett becomes a representation of that portion of the South’s population (both past and current) who cannot see past the perceived grandiosity of the past, yet she is also a representation of that same grandiosity. She, as well as those who cannot see the horrible truth behind the constructed legend of a South that never was, cannot look beyond her own interests to see the truth. There are numerous examples within the movie which show Scarlett’s lack of vision. She marries Charles Hamilton out of frustration and spite, in hopes of angering Ashley Wilkes; and she marries Frank Kennedy only to use his money to pay the taxes on Tara, thus protecting a home and way of life that can never return. She is an opportunist and a user. She seems to have no notion that her ideal childhood at Tara never really existed—it appeared care-free to her, but it was bought with the blood and sweat of an enslaved people. Scarlett never acknowledges this fact. She, as the lead character of the film, represents the great southern separation of perception from reality—a delusion still present at the 1939 premiere of the film. As Edward Campbell states in â€Å"The South as National Epic, 1939-1941: Gone with the Wind†: â€Å"One critic reported that thirty-eight survivors of the Civil War emerged from the theatre convinced that the movie was ‘true. . .to the South of their own childhoods.’† I postulate that the â€Å"survivors of the Civil War,† both those present at the premiere and those not, entered into a state of mass psychosis. The only way to deal with the atrocities of slavery and the pain and humiliation of the South’s defeat was to suppress them and turn them into something more palatable. In essence, certain Southerners made a ball gown out of their dingy curtains, and many have been dancing in the delusion ever since. I would like to say that this delusion is dead, but one need only look to Civil War reenactments and plantation-themed weddings to see that it is not. The most prominent example of Scarlett’s refusal to accept reality is found at the end of the film. Bonnie is dead, Rhett has left, and Scarlett has collapsed at the bottom of the staircase. Rather than accepting what is at hand, she stares into the camera and thinks of Tara again. Her longing for what was is still her driving force. She wants to go back and rebuild Tara (and possibly her relationship with Rhett), but it is impossible to do so. Scarlett will not accept this fact, and the movie ends on this perceived high note. This is appealing to those in the audience who refuse to accept reality. Movie goers buy in to Scarlett’s denial of her circumstances because they too deny their own. She cannot accept her lot in life, and neither can they. On pages 163 and 164 of â€Å"Spectacle/Gender/History: The Case of Gone with the Wind,† Tom Brown describes the â€Å"historical gaze† found in epic films such as Gone with the Wind as a kind of foresight found in the prominent figures in those movies. He states that they â€Å"seem endowed with a clairvoyance through which they appear to recognize events to come.† If this is the case, then Scarlett’s â€Å"gaze† only works in the short term and in reverse. She can only see the outcomes of her actions as they relate to her status, and she cannot see far into the future because she continually looks backward to the Tara of her youth. If anyone in the film has a real â€Å"historical gaze,† it would be the young man playing the horn in the middle of town as the lists of fallen soldiers are distributed. He is weeping as he plays an up-tempo song while the news of death is passed around. The ridiculousness of the whole situation is revealed as the camera singles in on his tear-filled eyes. The song the band plays sounds lively—almost celebratory—but it cannot mask the horror of the situation, just as Scarlett’s doggedness cannot restore Tara and her youth, and the delusions of grandeur associated with the antebellum South cannot erase the truth of its daily workings.

Saturday, May 23, 2020

Where Is The Line Between Depression And Being Depressed...

Where is the Line Between â€Å"Having Depression† and â€Å"Being Depressed†? I remember it well, the first time I thought I had depression. I was 17. My psychology textbook had innocently listed the symptoms of clinical depression, and I read them with increasing fervour, the cogs in my mind whirring and clicking into place. This is me! I thought, my obviously fully developed adult brain making proper conclusions. Equal feelings of dread and relief settled into the pit of my stomach. Despite my knowledge that psychology students have a tendency to incorrectly self-diagnose, this was my reality for the six years separating now and then. I maintained this belief through a detrimental concoction of confirmation bias and self-fulfilling prophecies. Countless times I’ve sat, mindless gaze fixed on the wall, eyes brimming with silent, slow tears. The void opens in my chest, I reach for my phone, then stop, with the helpless hesitation of one who truly believes that none of her friends will care. You are useless, my mind whispers. You are worthless. I stare listlessly at stucco ceilings, white and blank and empty; I hide within the folds of duvet covers; I wither within a trench of self-pity. The insidious beast settles in, to either destroy my relationships or render me useless in any endeavour. But, once the storm passes, I am myself again – ostensibly flatline but not necessarily depressed. Over the years my experience has not continued to be so bleak, though, and I discovered in myShow MoreRelatedSymptoms And Symptoms Of The Depression Essay1337 Words   |  6 PagesClinical depression is a disease that affects many people, ranging from children to elderly adults. Depression is a scary word to many and conjures up ugly, stereotypical images of people being sad all the time and wanting to kill themselves. Depression is treatable, but the same method of treatment will not be effective on every patient. Many people suffering from depression question whether they are actually depressed or just having a bad day. Often times, a person who believes they are sufferingRead MoreLife Is Like The Stanzas Of A Poem803 Words   |  4 Pageslife as poems. The troubled childhood and the depressed adulthood of Anne Sexton lead to the depressed and dark nature of her writing. Trauma from the abused childhood brought about the depressed nature of her poems. In Briar Rose (Sleeping Beauty), Anne sexton describes the troubled nature of her childhood. â€Å"I was forced backward. I was forced forward.† â€Å"Each night I am nailed into place.† (st.7,line 5-7.9) That feeling of being forced and helpless. Being drained of life by the one who was supposedRead MoreDepression And Suicide : Symptoms And Symptoms Essay1533 Words   |  7 PagesA family member could suffer from depression and I decide to study depression and suicide. When a family member aches from depression, your console and cheer can play a vital part in his or her recovery. Nevertheless, depression can break you down if you neglect your own wants. Depression is a serious but curable illness that disturbs a lot of individuals, from young to old people and all humans being. It becomes the part of everyday life, triggering massive pain, hurting not just individuals whoRead MoreThe Effects Of Depression On Children And Adolescents Essay998 Words   |  4 PagesThroughout history, we have heard the rhetoric expressed repeatedly that depression occurs in adulthood and that children and adolescents do not experience episodes of depression. The ailment of adulthood and depression is something that is not accurately especially given the current reality in face in society. According to the National Institute of Mental Health, in 2015, an estimated 3 million adolescents aged 12 to 17 in the United States had at least one major depressive episode in the past yearRead MoreWe Must Take Action Against Suicide957 Words   |  4 Pagesthe word suicide has never held the same context. Rather than teenage suicide being some controversy discussed in the news, it became a painful reality. Suicide, the deliberate act of ending ones own life, is currently on the rise and has become the third leading cause of death amongst adolescents and teenagers. In the past twenty-five years, the general occurrence of suicide has decreased, yet the rate for those between ages fifteen and twenty-four have tripled, ages that encompasses both high schoolRead MoreOne Of Holden’S Main Defense Mechanisms In The Novel Is1408 Words   |  6 Pagesisolation can derive from his constant depression.. Holden chooses to isolate himself many times throughout the storyline because of his saddening past. An article by Debbie Roome acknowledged â€Å"Depression is another prime cause of isolation. A depressed teen loses interest in everyday activities and drops out of social groups at school† (Roome). The reader will in fact see this early on in the book demonstrating Holden flunked out of his school! The quote â€Å"Where I want to start telling is the day IRead MoreExperiencing Depr ession Throughout Life Essay936 Words   |  4 Pagesexperience depression throughout their life? Introduction In psychology, depression is a mental illness in which a person experiences deep, unshakable sadness and diminished interest in nearly all activities, it involves disturbances in emotion(Encarta). Depression is among the most common mental illnesses. About 8 percent of adults in the United States experience serious depression through out their lives (Encarta). Women are about three times more likely to be depressed than menRead MoreA False Romance1236 Words   |  5 Pagesday to day realities of a relationship where people lose their temper or get annoyed. These are the parts that really test the relationship. They don’t show the challenges of being in long term relationships. It makes sense seeing how the movies only have a few hours to get the characters stories across. There are not many great movies that show relationship struggles. The audience does not want to see this side of the love story. People watch movies where the characters are perfect and they haveRead Mo reSuicide in the Trenches Analysis Essay1105 Words   |  5 Pagesis the meaning of war? What is war like? How do soldiers feel in a war? Glorious? Depressed? This poem accurately shows the harsh but sadly true reality of war - death, suicide and depression. Indeed, as quoted by Sir Williams Henry - â€Å"Nobody in his right mind would enjoy war†. The point of view is third person. This is effective in showing one case of suicide, in third person observation, representing the depression and desire to quickly die in everyone else. Life is really worse than death - andRead MoreAdolescent Depression and Suicide: Early Detection and Treatment the K1244 Words   |  5 PagesAdolescent Depression and Suicide: Early Detection and Treatment the Key Only in the past two decades has depression in adolescents been taken seriously. Depression is an illness that involves the body, mood and thoughts. It affects the way a person eats and sleeps, the way one feels about oneself, and the way one thinks about things. Therefore it comes to no surprise to discover that adolescent depression is strongly linked to teen suicide. Adolescent suicide is now responsible for more deaths

Monday, May 18, 2020

Essay on Men and Women, Perspectives on Communication

Men and Women, Perspectives on Communication Throughout time it has been documented that men and women see things in the world from different perspectives. A man will pay $2 for a $1 item he wants but a woman will pay $1 for a $2 item she doesnt want. Men and women’s minds are truly wired up differently, and I’m not just talking about sex. Making love, for most women is the greatest expression of intimacy a couple can achieve. To most men, you can call it whatever you want just as long as they end up in bed. (Actually, I hope that is my last sexual reference.) A woman knows all about her children. She knows about dentist appointments and romances, best friends, favorite foods, secret fears, and hopes and dreams. A man is vaguely aware†¦show more content†¦Henry states, â€Å"â€Å"Why, sure, that’s what I came to tell you. They†¦ got nearly my own price, too.† â€Å"Good† she said. â€Å"Good for you.† â€Å"And I thought,† he continued, â€Å"I thought how itâ₠¬â„¢s Saturday afternoon†¦ to celebrate, you see.† â€Å"Good† she repeated. â€Å"Oh, yes. That will be good.†Ã¢â‚¬  (361) Throughout the story, Elisa is unable to communicate with Henry to tell him how she really feels and Henry is either not perceptive enough or doesn’t want to figure out what is really troubling Elisa. When the Fix-it man arrives, there is a distinctive shift in her personality. She is chatty, witty and wanton to converse with someone other than her husband. I think this shows how Elisa sees her life on the Allen farm. She is not happy, she can’t communicate with her husband and she longs for a child of her own to keep her company. She uses the chrysanthemums as a surrogate for a number of things, a relationship with her husband, a child, other friends and family. Henry is oblivious to this, he is happy doing what men do, provide the staples for living for his family. They have a couple of near misses at genuine communicat ion, first when Henry comes down after dressing for dinner he commends Elisa on her beauty, â€Å"Why-why, Elisa. You look so nice!† (365) Henry is truly attentive to Elisa and she does not know how to react. Elisa stiffens and instead of taking theShow MoreRelatedExplanation Of The Muted Group Theory1573 Words   |  7 Pageswas originally developed to help scholars understand the co-cultural hypothetical framework of communications between genders. The muted group theory was initially established by British anthropologists Edwin and Shirley Ardener in the late 1960’s to discuss the difference in communications styles of the subordinate groups, which were mainly women when compared to the dominate groups, which were mainly men. (Orbe, M.P., 1997). In time a dominate group would be formed from a social hierarchy systemRead MoreThe Muted Group Theory Of The World Of Communication1627 Words   |  7 Pagesthroughout society has been men and women, men being the dominan t figure, and women being mute. The Muted Group Theory is one that explains why women or other minorities feel more constrained and obligated to conform to dominant figures. In the world of communication, men seem to have more influence over women especially in linguistics. Not only is language an important aspect throughout this theory, advertising has remained a crucial part as well. Advertising depicts women and minorities to be muteRead MoreReaction to Gender and Communication in Social Work Education850 Words   |  4 PagesThe differences of communication between male and female gender affect social work education when the 3 areas are concerned: training students for social work, interaction between staff members and interaction between students and faculty members. Communication is one very significant tool in the social work where teaching and developing of relations is concerned. This article explains gender difference from perspective of cross-culture. Men listen to act a ccordingly and women listen so that theyRead MoreCommunication Styles Between Men And Women1522 Words   |  7 Pageshealthy and happy marriage is critical. Unsuccessful communication plays a vital role in the failure of many marriages and relationships. Communication is key in all relationships and can lead to the success or failure of a marriage, depending on how the couple interacts. This effectiveness of communication is connected to the overall satisfaction of married couples. Learning more about the differences in communication styles between men and women will aid in the successful sending and receiving ofRead MoreWomen In Engineering1144 Words   |  5 PagesUniversities Provide Scholarships for Women in Engineering: A College’s Perspective Introduction In recent years, there have been consistently more women enrolled in undergraduate studies than men - in 2015, two million fewer men were in an undergraduate program in America. However, only 24% of people with occupations in STEM fields are women, and only 14% of the engineering field is women. It is widely accepted in the engineering world of jobs that more women would only be a benefit. However, theRead MoreGender Roles Of Women And Men Essay1485 Words   |  6 PagesAbstract Through many generations women were not treated equally as men. Women have fought their way to have gender equality but it has been slowly progressing. More women are starting to have high ranked jobs, more have been going into the workforce and don’t have to stay home all day long to take care of the kids. There are many differences between the gender roles (how women and men act or how they should be) when it comes to certain things. Like if you tell a girl, she hits like a boy or tellRead MoreGender Roles in European Culture869 Words   |  4 PagesThroughout history, women have made up a sort of â€Å"minority† in the world’s many societies. They have been looked upon as property to husbands and fathers. Their place was deemed the male’s home. Women were to provide services to men, ranging from carrying an heir (hopefully a male) to providing a clean home and cooked meals. Women in high-income nations still continue to face challenges because of thei r gender, and those in low-income nations often remain thought of as property. From a symbolic interactionistRead MoreWe ve Got The Dirt On Guy Brains By Dave Barry951 Words   |  4 PagesTannen’s â€Å"Sex, Lies, and Conversation† , the authors discussed the difference between men and women in terms of specific issues. However, their opinions of what reasons have led to certain differences diverged. This essay aimed at providing a detailed examination of both articles by comparing some of the points. First of all, I will discuss the shared point of both articles regarding the differences of men and women. Then the I will move on taking about the major different opinions the two authors heldRead MoreThe Characteristics Of Communication And How It Affects Male And Female Entrepreneurship1246 Words   |  5 PagesIntroduction This paper is a research done to analyze the characteristics of communication and how it affects male and female entrepreneurship. The use of gender perspective in the communication style was influenced by the now popular topic of women’s rights and discrimination against women in the business world. Women in business was scarce, but now it is becoming more prevalent. â€Å"The communication is a key factor in the success of any organization† (Borcic, Despot, Prusina 2015). The backgroundRead MoreMen vs Women (Compare and Contrast) Essays787 Words   |  4 PagesAs the age old saying goes, â€Å"Men Are from Mars, Women are from Venus†. The conflicting views of men and women have been questioned for centuries, noting how men and women differ in emotion, affection, and communication. Women tend to be more emotional and rational then men, whereas men are far less emotional and react on impulse. The different understanding of the ways that each sex communicates is still to be studied. Women tend to react more emotionally than men, resulting in submerging themselves

Monday, May 11, 2020

Critical Analysis Ralph Ellisons Invisible Man Essay

In Ralph Ellison’s Invisible Man, we are presented with an unnamed narrator whose values and potentials are invisible to the world around him. Throughout the entirety of the novel, we see the unnamed narrator, also known as the Invisible Man, struggle in an attempt to uncover his identity buried beneath African American oppression and an aggregation of deception. Ellison shows us how lies and deceit may serve as a grave but invaluable obstacle to one’s journey to find their identity. Through the use of imagery, symbols, and motifs of blindness along with invisibility, Ellison portrays the undeniable obstacle that deception plays in one’s ability to establish their identity along with the necessity of it. Within the opening chapter, the†¦show more content†¦The Battle Royal established the relationship between white power, male power, and (hetero)sexual power, the ‘self-grounding presumptions’ of dominant subjectivity, as central to the narrator’s embrace of abjection. Furthermore, it equates these structures or power with the visibility of disempowered bodies. (Jarenski 89) He was deceived by the white man whose approval he so desperately craved. However, this lie and deceit is one necessary to his journey to find his identity. It was essential for the Invisible Man to face this hard pressed reality and embrace the abjection. The Battle Royal inexplicably defined the dominance of the white male throughout this time. Without knowing of the unfortunate white male dominance of the times, he would never be able to see past the fog of lies that is omnipresent throughout the entire novel. â€Å"The [Invisible Man looked] to find identity within the roles assigned to him by the white audience. His primary concern [was] how they [would] perceive his dual role as a participant and a speaker† (Jarenski 89). He longed for their approval, unconsciously knowing that with their approval and acceptance his ability to establish his identity would be facile. It was vital for the Invisible Man to learn this arduous lesson. He needed to be acquainted with the idea that the white man is all powerful and also all ambiguous. Unfortunately, at the end of the night, the superintendent presented the Invisible ManShow MoreRelatedInvisible Man by Ralph Ellison Essay1403 Words   |  6 Pages nbsp;nbsp;nbsp;nbsp;nbsp;In Ralph Ellison’s novel, Invisible Man, the narrator is a young, African-American male who believes that he is invisible. Throughout the novel, he spends a great amount of time and effort trying to figure out his identity and find a way to make himself visible in society. One of the narrator’s main attempts brings him to join an organization known as the Brotherhood, where he is able to utilize his talent for public speaking as an advocate for the Brotherhood and allRead MoreUsing Psychoanalysis to Understand Human Behavior Essay4081 Words   |  17 PagesIn fact, the psychoanalyst Jacques Lacan wrote, If psycho-analysis is to be constituted as the science of the unconscious, one must set out from the notion tha t the unconscious is structured like a language,(1) thus directly relating literature – the art of language - and psychoanalysis. Searching the database of the Modern Language Association for articles about the use of psychoanalysis for understanding Ralph Ellison’s Invisible Man yields one article by Caffilene Allen, of Georgia State University

Wednesday, May 6, 2020

The Effectiveness Of Cbt Versus Ipt During The Treatment...

The Effectiveness of CBT versus IPT in the Treatment of Severe Depression Globally, major depressive disorder (MDD) is among the top five public health concerns today (Cuijpers et al., 2011; Jakobsen, Hansen, Simonsen, Gluud, 2011; Hees, Rotter, Ellermann, Evers, 2013). Moreover, almost 20% of patients with depression engage in self-harming behaviors, including suicidal attempts (Gamble et al., 2013; Jakobsen et al., 2011). Not only is the prevalence of depression alarming, but costly to the health care system (Cuijpers et al., 2011; Cuijpers et al., 2014; Hees et al., 2013; Jakobsen et al., 2011). The use of antidepressants is the standard for initial treatment, but may be limiting in preventing relapse (Cuijpers et al., 2014; Jakobsen et al., 2011). Therefore, the inclusion of non-pharmacological interventions may be necessary to improve treatment outcomes (Cuijpers et al., 2011; Dekker et al., 2013; Jakobsen et al., 2011). Interpersonal psychotherapy (IPT) and cognitive behavi or therapy (CBT) are the two primary psychotherapeutic interventions recommended in the treatment of depression. In this paper, I will discuss the difference between CBT and IPT, compare the effectiveness between both therapies, explore their efficacy as an adjunct treatment with antidepressant medications, and summarize the treatment guidelines for depression. Cognitive Behavioral Therapy versus Interpersonal Psychotherapy Cognitive behavioral therapy is defined as short-term structuredShow MoreRelatedDifferent Treatments Of Depression / Anxiety And Their Effectiveness1622 Words   |  7 PagesDifferent Treatments of Depression/Anxiety and their Effectiveness For years, the ideal treatment of depression/anxiety has been pretty much up in the air with literature that shows mixed results for responses to various treatments. Pharmacotherapy or treatment via medicine, and psychotherapy treatment via talk therapy are the two types paths for those with a diagnosis of depression/anxiety that will be considered. Depression is a disorder that globally effects more than 350 million people todayRead MoreThe Integration of Interpersonal Psychotherapy and Cognitive Behavioral Therapy2247 Words   |  9 PagesInterpersonal Psychotherapy (IPT) is a short-term psychotherapy that was developed by Myrna Weissman and Gerald Klerman in the 1980’s. It focuses on the interpersonal relationships in the client’s life, instead of on past or biological causes. The therapy is kept fairly structured by the clinician’s use of a manual and aims to help the client recover from their current episode of depression. Interpersonal Psychotherapy ha s been used in conjunction with Cognitive Behavioral Therapy (CBT) in research studies

Bioinformatics Free Essays

Full report on BIOINFORMATICS PURIFICACION, MARYNOLD V. CHEM 161. 1 3L 2nd Semester AY 2012-1013 GROUPMATES: Donato, Lualhati M. We will write a custom essay sample on Bioinformatics or any similar topic only for you Order Now Diaz, Manuelle Marie C. Date Submitted: March 8, 2013 Laboratory Instructor: Ms. Herra Grajo I. INTRODUCTION Bioinformatics is the branch of  biological  science which deals with the study of methods for storing, retrieving and analyzing biological data, such as  nucleic acid  (DNA/RNA) and protein sequence, structure, function,  pathways  and  genetic interactions. It is very important since it contains large amount of information regarding biomolecules that a human mind is not able to store and process such data. There are different data bases that can be used like National Center for Biotechnology Information (NCBI), European Molecular Biology Laboratory-European Bioinformatics Institute database (EMBL-EBI), GenBank (US-based), SwissProt/UniProt, DNA Data Bank of Japan (DDBJ), Entrez and PubMed. Basic  Local  Alignment  Search  Tool, or  BLAST, is an  algorithm  for associating  primary  biological sequence information, like amino-acid  sequences of various  proteins  or the  nucleotides  of  DNA sequences. A BLAST search allows a researcher to compare a query sequence with a library or  database  of sequences, and identify library sequences that resemble the query sequence above a certain threshold. The BLAST program was designed by  Stephen Altschul,  Warren Gish,  Webb Miller,  Eugene Myers, and David J. Lipman  at the  NIH  and was published in the  Journal of Molecular Biology  in 1990. On the other hand,ProtParam is a very useful softwarethat can compute various physico-chemical properties from a protein sequence. The parameters that can be computed by ProtParam include the molecular weight, theoretical pI, amino acid composition, atomic composition, extinction coefficient, estimated half-life, instability index, aliphatic index and grand average of hydropathicity (GRAVY). At the end of this exercise, the student should be able to understand the concept and process of bioinformatics; to know the process on how to use computer programs related in biological information; and to apply these programs on different protein sequences and identify different informations using these programs. II. METHODOLOGY The FASTA sequence of the given proteins namely; Myk, Gi, Glean, Astara, Niko, SR, Joma, Melai, Danne, Jay, Annie and Hani were analyzed using BLAST and ProtParam. BLAST showed the protein with that given sequence and its function was researched. ProtParam, on the other hand, showed the amino acid composition of the given protein, its theoretical IpH, estimated molecular weight and other pertinent information. III. RESULTS AND DISCUSSION Bioinformatics is the branch of  biological  science which deals with the study of methods for storing, retrieving and analyzing biological data, such as  nucleic acid  (DNA/RNA) and protein sequence, structure, function,  pathways  and  genetic interactions. In this exercise, the computer program called Basic Local Alignment Search Tool (BLAST) was used to identify different protein sequences and determine the function of these proteins. Also, a computer program named ProtParam was used to determine the IpH and estimated molecular weight of the said proteins. Different sequences of proteins were analyzed using these 2 algorithms to study their identities, properties and purposes. Table 1 show the list of the given protein sequences, their identity, their theoretical IpH and estimated molecular weight. The FASTA sequences of the different codes are also shown below. PROTEIN SEQUENCES: Myk qavlslyasgrttgivldsgdgvthtvpiyegfalphailrldlagrdltdalmkiltergysftttaereivrdikeklayvaldyeqelesa Gi mftasqegdgmskshvhrsvwwswlvgvltvvglglglgsgvglapgsaapsglaldrfadrplapidps Glean mmvawwslflyglqvaapalaatpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftaiwitpvtar Astara kkkslalvlatgmavttfggtgsafadsknvlstkkynetvqspefvsgdlteatgkkaesvvfdylnaakgdyklgeksaqdcfkvkqakkdavtdst Niko mgsigaasmefcfdvfkelkvhhanenifycpiaimsalamvylgakdstrtqinkvvrfdklpgfgdsieaqcgtsvnvhsslrdil SR ndfnlqdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdvirrfkaskfgskdgvgtvfdafpdqvaiqlndthpalaipel Joma vgeimnskrdaeavgpeafadedfderevrgigkflhsakkfgkafvgeimnskrdaeavgpeafadedlderevrgigkflhsakkf gk Melai tedskgghpfssetkeklnkeggafpgpsgslkfcpleiaqklwkenhseiypimktptrtrlaliicstdfqhlsrrvgadvdlremklllqdlgytvkvkenltale Danne kllravitcltypekhfekvlrlsinkmgtdewgltrvvttrtevdmerikeeyqrrnsipldraiakdtsgdyedmlvallghgda Jay sltafndlklgkkykfilfglndakteivvketstdpsydafleklpendclyaiydfeyeingnegkrskivfftwspdtapvrskmvyasskdalrr Annie kakyltemprasellshgipykankravpdridwresgyvtevkdqggcgscwafsttgamegqymknektsisfseqqlvdcsgpfgnygcngglmena Hani valkgfakffkessdeerehaeklmeyqnkrggrvrlqsivtpltefdhpekgdalyamelalaleklvneklhnlhgvatrcndpqltdfieseflee Table 1. Identity, IpH and molecular weight of different protein sequences. Name| Identity| IpH| Molecular weight, g/mol| Myk| NBD_sugar-kinase_HSAP70_actin superfamilyActin| 4. 72| 10344. 7| Gi| Pepsin A trypsin| 5. 97| 7144. 1| Glean| AmyAC_family superfamilyAmylase A| 5. 93| 10002. 4| Astara| Protease| 8. 97| 10595. 0| Niko| SERPIN superfamilySerpin ovalbumin| 6. 24| 9899. 4| SR| Glycosyltransferase_GTB_type superfamilyGlycogen phosphorylase| 4. 65| 11336. 7| Joma| Magainin| 5. 21| 9931. 1| Melai| CASc superfamilyCaspase| 7. 73| 12230. 0| Danne| Annexin superfamilyAnnexin| 6. 14| 10022. 5| Jay| ADF_gelsolon superfamilyCofilin| 5. 47| 11504. 0| Annie| Peptidase_C1ACathepsin| 5. 80| 10982. 2| Hani| Euk_FerritinFerritin_like superfamilyFerritin| 5. 06| 11519. 9| Actin forms  microfilaments  which are typically one of the most dynamic of the three subclasses of the eukaryotic  cytoskeleton. In turn, this gives actin major functions in cells: * To form  microfilaments  to give mechanical support to cells, and provide trafficking routes through the cytoplasm to support signal transduction. * To allow  cell motility  in cells which undergo  amoeboid  motion using  pseudopods and  phagocytosis, for example of bacteria by  macrophages. * In  metazoan  muscle  cells, to be the scaffold on which  myosin  proteins generate force to support muscle contraction. In nonmuscle cells, to be a track for cargo transport myosins (nonconventional myosins) such as myosin V and VI. Nonconventional myosins use ATP hydrolysis to transport cargo, such as  vesicles  and organelles, in a directed fashion much faster than diffusion. Myosin V walks towards the barbed end of actin filaments, while myosin VI walks toward the pointed end. Most actin filaments are arranged with the barbed end toward the cellular membrane and the pointed end toward the cellular interior. This arrangement allows myosin V to be an effective motor for export of cargos, and myosin VI to be an effective motor for import. Pepsin  is an  enzyme  whose  zymogen  (pepsinogen) is released by the  chief cells  in the  stomach  and that degrades food  proteins  into  peptides. The ? -amylases (EC  3. 2. 1. 1  ) (CAS# 9014-71-5) (alternative names: 1,4-? -D-glucan glucanohydrolase; glycogenase)are  calcium  metalloenzymes, completely unable to function in the absence of calcium. By acting at random locations along the starch chain, alpha-amylase breaks down ling-chain carbohydrates, ultimately yielding maltotriose and maltose from amyloase, glucose and â€Å"limit dextrin† from amylopectin. It can act anywhere on the  substrate, ? amylase tends to be faster-acting than ? -amylase. In  animals, it is a major  digestive  enzyme, and its optimum pH is 6. 7-7. 0. In human physiology, both the salivary and pancreatic amylases are ? -amylases. A  protease  (also termed  peptidase  or  proteinase) is any  enzyme  that conducts  proteolysis, that is, beg ins  protein  catabolism  by  hydrolysis  of the  peptide bonds  that link  amino acids  together in thepolypeptide  chain forming the protein. Serpins  are a group of  proteins  with similar structures that were first identified as a set of proteins able to  inhibit  proteases. Glycogen phosphorylase catalyzes the rate-limiting step in  glycogenolysis  in animals by releasing  glucose-1-phosphate  from the terminal alpha-1,4-glycosidic bond. Ovalbumin  (OVA) is the main  protein  found in  egg white, making up 60-65% of the total protein. Ovalbumin displays sequence and three-dimensional  homology  to the  serpin  superfamily, but unlike most serpins it is not a  serine protease  inhibitor. The function of ovalbumin is unknown, although it is presumed to be a  storage protein. Ovalbumin is an important protein in several different areas of research, including:general studies of protein structure and propertiesbecause it is available in large quantities; studies of serpin structure and function since ovalbumin does not inhibit proteases which means that by comparing its structure with that of inhibitory serpins, the structural characteristics required for inhibition can be determined; in proteomics  where it is used as a molecular weight marker for calibrating  electrophoresis  gel; and in immunology where it is commonly used to stimulate an  allergic reaction  in test subjects likean established model allergen for  airway hyper-responsiveness, AHR. Caspases, or  cysteine-aspartic or  cysteine-dependent  aspartate-directed proteases  are a family of  cysteine proteases  that play essential roles inapoptosis  (programmed cell death),  necrosis, and  inflammation. Caspase 1/interleukin-1 converting enzyme is an  enzyme  that  proteolytically  cleaves other proteins, such as the  precursor  forms of the inflammatorycytokines  interleukin 1-? and  interleukin 18, into active mature peptides. It belongs to a family of  cysteine proteases  known as  caspases  that always cleave proteins following an  aspartic acid  residue. Caspase 1 has been shown to induce cell  necrosis  or  pyroptosis  and may function in various developmental stages. Studies of a similar protein in mouse suggest a role in the pathogenesis of  Huntington’s disease. Alternative splicing  of the gene results in five transcript variants encoding distinct isoforms. Annexins have been observed to play a role along the  exocytotic  pathway, specifically in the later stages, near or at the plasma membrane. Annexins have been found to be the later stages, near or at the plasma membrane. Annexins have been found to be involved in the transport and also sorting of endocytotic events. Annexin one is a substrate of the EGF (epidermal growth factor)  tyrosine kinase  which becomes phosphorylated on its N terminus when the receptor is internalized. Cofilin is a ubiquitous actin-binding factor required for the reorganization of actin filaments. ADF/Cofilin family members bind G-actin monomers and depolymerize actin filaments through two mechanisms: severing and increasing the off-rate for actin monomers from the pointed end. Older† ADP/ADP-Pi actin filaments free of tropomyosin and proper pH are required for cofilin to function effectively. In the presence of readily available ATP-G-actin cofilin speeds-up actin polymerization via its actin- severing activity (providing free barbed ends for further polymerization and nucleation by the Arp2/3 complex). As a long-lasting  in vivo  effect, cofilin recycles older ADP-F-actin, helping cell to maintain ATP-G-actin pool for sustained motility. pH, phosphorylation and phosphoinositides regulate cofilin’s binding and associating activity with actin The  Arp2/3 complex  and cofilin work together to reorganize the actin filaments in the  cytoskeleton. Arp 2/3, an actin binding proteins complex, binds to the side of ATP-F-actin near the growing barbed end of the filament, causing nucleation of a new F-actin branch, while cofilin-driven depolymerization takes place after dissociating from the Arp2/3 complex. They also work together to reorganize microtubules in order to traffic more proteins by vesicle to continue the growth of filaments. Cofilin also binds with other proteins such as  myosin,  tropomyosin,  ? -actinin,  gelsolin  and  scruin. These proteins compete with cofilin for actin binding. ?ofilin also play role in innate immune response. Cathepsins have a vital role in mammalian cellular turnover, e. g. bone resorption. They degrade  polypeptides  and are distinguished by their  substrate  specificites. Ferritin serves to store iron in a non-toxic form, to deposit it in a safe form, and to transport it to areas where it is required. Knowing the protein sequence gives many advantages in studies especially dealing with medicine. The protein of interest whether it is the cause of the abnormality or the cure for abnormality can be identified with just few clicks. The reasons behind similarity of protein sequences despite diversity of source organism is because even though all protein families have distinct functional compositions across different species, some conserved functional features among family members included a shared reaction mechanism, cofactor usage, and/or ligand specificity. IV. SUMMARY AND CONCLUSION Bioinformatics is the branch of  biological  science which deals with the study of methods for storing, retrieving and analyzing biological data, such as  nucleic acid  (DNA/RNA) and protein sequence, structure, function,  pathways  and  genetic interactions. It is very important since it contains large amount of information regarding biomolecules that a human mind is not able to store and process such data. Basic  Local  Alignment  Search  Tool (BLAST), an  algorithm  for associating  primary  biological sequence information, like amino-acid  sequences of various  proteins  or the  nucleotides  of  DNA sequences; and ProtParam, a very useful software that can compute various physico-chemical properties from a protein sequence. Such parameters include the molecular weight, theoretical pI, amino acid composition, atomic composition, extinction coefficient, estimated half-life, instability index, How to cite Bioinformatics, Essay examples Bioinformatics Free Essays Full report on BIOINFORMATICS PURIFICACION, MARYNOLD V. CHEM 161. 1 3L 2nd Semester AY 2012-1013 GROUPMATES: Donato, Lualhati M. We will write a custom essay sample on Bioinformatics or any similar topic only for you Order Now Diaz, Manuelle Marie C. Date Submitted: March 8, 2013 Laboratory Instructor: Ms. Herra Grajo I. INTRODUCTION Bioinformatics is the branch of  biological  science which deals with the study of methods for storing, retrieving and analyzing biological data, such as  nucleic acid  (DNA/RNA) and protein sequence, structure, function,  pathways  and  genetic interactions. It is very important since it contains large amount of information regarding biomolecules that a human mind is not able to store and process such data. There are different data bases that can be used like National Center for Biotechnology Information (NCBI), European Molecular Biology Laboratory-European Bioinformatics Institute database (EMBL-EBI), GenBank (US-based), SwissProt/UniProt, DNA Data Bank of Japan (DDBJ), Entrez and PubMed. Basic  Local  Alignment  Search  Tool, or  BLAST, is an  algorithm  for associating  primary  biological sequence information, like amino-acid  sequences of various  proteins  or the  nucleotides  of  DNA sequences. A BLAST search allows a researcher to compare a query sequence with a library or  database  of sequences, and identify library sequences that resemble the query sequence above a certain threshold. The BLAST program was designed by  Stephen Altschul,  Warren Gish,  Webb Miller,  Eugene Myers, and David J. Lipman  at the  NIH  and was published in the  Journal of Molecular Biology  in 1990. On the other hand,ProtParam is a very useful softwarethat can compute various physico-chemical properties from a protein sequence. The parameters that can be computed by ProtParam include the molecular weight, theoretical pI, amino acid composition, atomic composition, extinction coefficient, estimated half-life, instability index, aliphatic index and grand average of hydropathicity (GRAVY). At the end of this exercise, the student should be able to understand the concept and process of bioinformatics; to know the process on how to use computer programs related in biological information; and to apply these programs on different protein sequences and identify different informations using these programs. II. METHODOLOGY The FASTA sequence of the given proteins namely; Myk, Gi, Glean, Astara, Niko, SR, Joma, Melai, Danne, Jay, Annie and Hani were analyzed using BLAST and ProtParam. BLAST showed the protein with that given sequence and its function was researched. ProtParam, on the other hand, showed the amino acid composition of the given protein, its theoretical IpH, estimated molecular weight and other pertinent information. III. RESULTS AND DISCUSSION Bioinformatics is the branch of  biological  science which deals with the study of methods for storing, retrieving and analyzing biological data, such as  nucleic acid  (DNA/RNA) and protein sequence, structure, function,  pathways  and  genetic interactions. In this exercise, the computer program called Basic Local Alignment Search Tool (BLAST) was used to identify different protein sequences and determine the function of these proteins. Also, a computer program named ProtParam was used to determine the IpH and estimated molecular weight of the said proteins. Different sequences of proteins were analyzed using these 2 algorithms to study their identities, properties and purposes. Table 1 show the list of the given protein sequences, their identity, their theoretical IpH and estimated molecular weight. The FASTA sequences of the different codes are also shown below. PROTEIN SEQUENCES: Myk qavlslyasgrttgivldsgdgvthtvpiyegfalphailrldlagrdltdalmkiltergysftttaereivrdikeklayvaldyeqelesa Gi mftasqegdgmskshvhrsvwwswlvgvltvvglglglgsgvglapgsaapsglaldrfadrplapidps Glean mmvawwslflyglqvaapalaatpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftaiwitpvtar Astara kkkslalvlatgmavttfggtgsafadsknvlstkkynetvqspefvsgdlteatgkkaesvvfdylnaakgdyklgeksaqdcfkvkqakkdavtdst Niko mgsigaasmefcfdvfkelkvhhanenifycpiaimsalamvylgakdstrtqinkvvrfdklpgfgdsieaqcgtsvnvhsslrdil SR ndfnlqdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdvirrfkaskfgskdgvgtvfdafpdqvaiqlndthpalaipel Joma vgeimnskrdaeavgpeafadedfderevrgigkflhsakkfgkafvgeimnskrdaeavgpeafadedlderevrgigkflhsakkf gk Melai tedskgghpfssetkeklnkeggafpgpsgslkfcpleiaqklwkenhseiypimktptrtrlaliicstdfqhlsrrvgadvdlremklllqdlgytvkvkenltale Danne kllravitcltypekhfekvlrlsinkmgtdewgltrvvttrtevdmerikeeyqrrnsipldraiakdtsgdyedmlvallghgda Jay sltafndlklgkkykfilfglndakteivvketstdpsydafleklpendclyaiydfeyeingnegkrskivfftwspdtapvrskmvyasskdalrr Annie kakyltemprasellshgipykankravpdridwresgyvtevkdqggcgscwafsttgamegqymknektsisfseqqlvdcsgpfgnygcngglmena Hani valkgfakffkessdeerehaeklmeyqnkrggrvrlqsivtpltefdhpekgdalyamelalaleklvneklhnlhgvatrcndpqltdfieseflee Table 1. Identity, IpH and molecular weight of different protein sequences. Name| Identity| IpH| Molecular weight, g/mol| Myk| NBD_sugar-kinase_HSAP70_actin superfamilyActin| 4. 72| 10344. 7| Gi| Pepsin A trypsin| 5. 97| 7144. 1| Glean| AmyAC_family superfamilyAmylase A| 5. 93| 10002. 4| Astara| Protease| 8. 97| 10595. 0| Niko| SERPIN superfamilySerpin ovalbumin| 6. 24| 9899. 4| SR| Glycosyltransferase_GTB_type superfamilyGlycogen phosphorylase| 4. 65| 11336. 7| Joma| Magainin| 5. 21| 9931. 1| Melai| CASc superfamilyCaspase| 7. 73| 12230. 0| Danne| Annexin superfamilyAnnexin| 6. 14| 10022. 5| Jay| ADF_gelsolon superfamilyCofilin| 5. 47| 11504. 0| Annie| Peptidase_C1ACathepsin| 5. 80| 10982. 2| Hani| Euk_FerritinFerritin_like superfamilyFerritin| 5. 06| 11519. 9| Actin forms  microfilaments  which are typically one of the most dynamic of the three subclasses of the eukaryotic  cytoskeleton. In turn, this gives actin major functions in cells: * To form  microfilaments  to give mechanical support to cells, and provide trafficking routes through the cytoplasm to support signal transduction. * To allow  cell motility  in cells which undergo  amoeboid  motion using  pseudopods and  phagocytosis, for example of bacteria by  macrophages. * In  metazoan  muscle  cells, to be the scaffold on which  myosin  proteins generate force to support muscle contraction. In nonmuscle cells, to be a track for cargo transport myosins (nonconventional myosins) such as myosin V and VI. Nonconventional myosins use ATP hydrolysis to transport cargo, such as  vesicles  and organelles, in a directed fashion much faster than diffusion. Myosin V walks towards the barbed end of actin filaments, while myosin VI walks toward the pointed end. Most actin filaments are arranged with the barbed end toward the cellular membrane and the pointed end toward the cellular interior. This arrangement allows myosin V to be an effective motor for export of cargos, and myosin VI to be an effective motor for import. Pepsin  is an  enzyme  whose  zymogen  (pepsinogen) is released by the  chief cells  in the  stomach  and that degrades food  proteins  into  peptides. The ? -amylases (EC  3. 2. 1. 1  ) (CAS# 9014-71-5) (alternative names: 1,4-? -D-glucan glucanohydrolase; glycogenase)are  calcium  metalloenzymes, completely unable to function in the absence of calcium. By acting at random locations along the starch chain, alpha-amylase breaks down ling-chain carbohydrates, ultimately yielding maltotriose and maltose from amyloase, glucose and â€Å"limit dextrin† from amylopectin. It can act anywhere on the  substrate, ? amylase tends to be faster-acting than ? -amylase. In  animals, it is a major  digestive  enzyme, and its optimum pH is 6. 7-7. 0. In human physiology, both the salivary and pancreatic amylases are ? -amylases. A  protease  (also termed  peptidase  or  proteinase) is any  enzyme  that conducts  proteolysis, that is, beg ins  protein  catabolism  by  hydrolysis  of the  peptide bonds  that link  amino acids  together in thepolypeptide  chain forming the protein. Serpins  are a group of  proteins  with similar structures that were first identified as a set of proteins able to  inhibit  proteases. Glycogen phosphorylase catalyzes the rate-limiting step in  glycogenolysis  in animals by releasing  glucose-1-phosphate  from the terminal alpha-1,4-glycosidic bond. Ovalbumin  (OVA) is the main  protein  found in  egg white, making up 60-65% of the total protein. Ovalbumin displays sequence and three-dimensional  homology  to the  serpin  superfamily, but unlike most serpins it is not a  serine protease  inhibitor. The function of ovalbumin is unknown, although it is presumed to be a  storage protein. Ovalbumin is an important protein in several different areas of research, including:general studies of protein structure and propertiesbecause it is available in large quantities; studies of serpin structure and function since ovalbumin does not inhibit proteases which means that by comparing its structure with that of inhibitory serpins, the structural characteristics required for inhibition can be determined; in proteomics  where it is used as a molecular weight marker for calibrating  electrophoresis  gel; and in immunology where it is commonly used to stimulate an  allergic reaction  in test subjects likean established model allergen for  airway hyper-responsiveness, AHR. Caspases, or  cysteine-aspartic or  cysteine-dependent  aspartate-directed proteases  are a family of  cysteine proteases  that play essential roles inapoptosis  (programmed cell death),  necrosis, and  inflammation. Caspase 1/interleukin-1 converting enzyme is an  enzyme  that  proteolytically  cleaves other proteins, such as the  precursor  forms of the inflammatorycytokines  interleukin 1-? and  interleukin 18, into active mature peptides. It belongs to a family of  cysteine proteases  known as  caspases  that always cleave proteins following an  aspartic acid  residue. Caspase 1 has been shown to induce cell  necrosis  or  pyroptosis  and may function in various developmental stages. Studies of a similar protein in mouse suggest a role in the pathogenesis of  Huntington’s disease. Alternative splicing  of the gene results in five transcript variants encoding distinct isoforms. Annexins have been observed to play a role along the  exocytotic  pathway, specifically in the later stages, near or at the plasma membrane. Annexins have been found to be the later stages, near or at the plasma membrane. Annexins have been found to be involved in the transport and also sorting of endocytotic events. Annexin one is a substrate of the EGF (epidermal growth factor)  tyrosine kinase  which becomes phosphorylated on its N terminus when the receptor is internalized. Cofilin is a ubiquitous actin-binding factor required for the reorganization of actin filaments. ADF/Cofilin family members bind G-actin monomers and depolymerize actin filaments through two mechanisms: severing and increasing the off-rate for actin monomers from the pointed end. Older† ADP/ADP-Pi actin filaments free of tropomyosin and proper pH are required for cofilin to function effectively. In the presence of readily available ATP-G-actin cofilin speeds-up actin polymerization via its actin- severing activity (providing free barbed ends for further polymerization and nucleation by the Arp2/3 complex). As a long-lasting  in vivo  effect, cofilin recycles older ADP-F-actin, helping cell to maintain ATP-G-actin pool for sustained motility. pH, phosphorylation and phosphoinositides regulate cofilin’s binding and associating activity with actin The  Arp2/3 complex  and cofilin work together to reorganize the actin filaments in the  cytoskeleton. Arp 2/3, an actin binding proteins complex, binds to the side of ATP-F-actin near the growing barbed end of the filament, causing nucleation of a new F-actin branch, while cofilin-driven depolymerization takes place after dissociating from the Arp2/3 complex. They also work together to reorganize microtubules in order to traffic more proteins by vesicle to continue the growth of filaments. Cofilin also binds with other proteins such as  myosin,  tropomyosin,  ? -actinin,  gelsolin  and  scruin. These proteins compete with cofilin for actin binding. ?ofilin also play role in innate immune response. Cathepsins have a vital role in mammalian cellular turnover, e. g. bone resorption. They degrade  polypeptides  and are distinguished by their  substrate  specificites. Ferritin serves to store iron in a non-toxic form, to deposit it in a safe form, and to transport it to areas where it is required. Knowing the protein sequence gives many advantages in studies especially dealing with medicine. The protein of interest whether it is the cause of the abnormality or the cure for abnormality can be identified with just few clicks. The reasons behind similarity of protein sequences despite diversity of source organism is because even though all protein families have distinct functional compositions across different species, some conserved functional features among family members included a shared reaction mechanism, cofactor usage, and/or ligand specificity. IV. SUMMARY AND CONCLUSION Bioinformatics is the branch of  biological  science which deals with the study of methods for storing, retrieving and analyzing biological data, such as  nucleic acid  (DNA/RNA) and protein sequence, structure, function,  pathways  and  genetic interactions. It is very important since it contains large amount of information regarding biomolecules that a human mind is not able to store and process such data. Basic  Local  Alignment  Search  Tool (BLAST), an  algorithm  for associating  primary  biological sequence information, like amino-acid  sequences of various  proteins  or the  nucleotides  of  DNA sequences; and ProtParam, a very useful software that can compute various physico-chemical properties from a protein sequence. Such parameters include the molecular weight, theoretical pI, amino acid composition, atomic composition, extinction coefficient, estimated half-life, instability index, How to cite Bioinformatics, Papers Bioinformatics Free Essays As the world has changed into computer based and more of technology based, so has the various fields changed. Molecular biology is concerned with how the systems of a cell interact which also includes the DNA and RNA interactions plus the protein biosynthesis. It therefore involves several techniques which include Polymerase Chain Reactions, Western Blotting, southern blotting, expression cloning, gel electrophoresis and so many other techniques. We will write a custom essay sample on Bioinformatics or any similar topic only for you Order Now Since it is mostly involved in the interactions of the cell systems, it requires means to be able to identify the DNA which are similar, if the DNA of some organism are evolving, if some mutation in a DNA can help in new inventions about how to deal with certain problems of the world among others. Determination of all these requires the use of information technology. There have been major advances in molecular biology and advances in technologies of genomic study too. This is the reason why there has been growth in biological information created by the scientists (Gibas and Jambeck, 2001). Because of these advances, genomic information has to be computerized and stored in databases in an organized manner for use. The databases are organized in a manner that scientists can retrieve information about a genome and more, add more information if need be and for future references (Gibas and Jambeck, 2001). It therefore means that the databases index the data for viewing and analysis purposes. Application of information technology in the field of molecular biology is what is known as Bioinformatics. It involves the creation of algorithms statistical techniques, databases and computational techniques in molecular biology. There are theories on how the biological data should be solved and how they should be managed. These are the theories that are the base of computation, data storage, data analysis and formation of algorithms (Letovsky, 1999). Bioinformatics This is a field of science, created due to the changing world enabling advances in molecular biology, that merge molecular biology, information technology and computer science together (Baxevanis and Ouellette, 2001). It is therefore a single discipline meant to make possible biological insight discoveries. It also creates an international perspective of biological principles discernation (Letovsky, 1999). As has been noted, this field was created due to the advances in molecular biology. At the beginning, as the world of computer began to take over, Bioinformatics was just meant for biological information storage. It was as simple as creation of the databases and maintaining them. Information stored at that time was amino acid sequences and nucleotide sequences. At this time though, the researchers could retrieve information and put in more either revised or new invention (Baxevanis and Ouellette, 2001). As time and more advances are being made and more information is needed about the interaction of the cell system, Bioinformatics is evolving too. It is getting more complex with more information and more activities on molecular biology. This is due to the need to comprehend the normal cellular activities so that any abnormalities can be easily detected. Bioinformatics currently provides options of analysis and interpretation of data. Most analyzed and interpreted data include amino acid sequences, nucleotide sequences, structures of protein and protein domains. This is what is referred to as computational biology (Baxevanis and Ouellette, 2001). There are two sub disciplines in Bioinformatics and computational biology. One is algorithm and statistics development for the assessment of large data sets. This includes data sets such as gene allocation from a specific sequence, formation of protein families from related protein sequences, protein structure prediction and protein function prediction (Westhead et al. , 2002). The other sub discipline is information management which requires development of tools that allow retrieval, use and management of information (Westhead et al. , 2002). Importance of Bioinformatics Since there is advancement in the world of technology, bioinformatics is to improve the understanding of the so many biological processes. This involves research areas of involvement such as evolutionary biology, gene expression analysis, analysis of cancer mutations, determination of biodiversity, analysis of sequences, comparative genomics, genome annotation and several others (Lesk, 2005). Gene Expression Analysis As this information technology system enables storage of information, analysis and interpretation, gene expression can be performed. This is done by the use of appropriate techniques which measure RNA levels such as sequencing of expressed complementary DNA, Serial Analysis of Gene Expression, micro arrays and so many other techniques. This is important in the determination of genes expressed in certain disorders (Lesk, 2005). Determination of such kinds of genes is important in the development of therapies, as developments have gone further in molecular biology so that disorders can be corrected using gene therapies. An example is gene replacement therapy. When a gene causing a specific disorder or disease is determined, a means of replacing it with a normal one could also be determined (Lesk, 2005). Evolutionary Biology Bioinformatics enables measurement of changes in the DNA of animals therefore determination of origins of evolution of animals from their ancestors. Other ways in which Bioinformatics has enabled researchers to study the origins of organism and animal species is through comparison of their genomes, hence classifying animals that originated from the same ancestor. Bioinformatics through computational models enable prediction of system outcome over a specified period of time (Lesk, 2005). Analysis of Sequences There are so many sequences that decode different proteins. These sequences are made available in the databases. This provides sequences for analysis, for example if a scientist has a sequence of a gene obtained from a species of organism and would like to know the sequence, he/she would check with the sequences in the data bases. In these databases, the information helps determine the genes that encode specific polypeptides and regulatory sequences. Sequence analysis also enables comparison of genes of species hence determination of certain protein functions (Lesk, 2005). Biodiversity Measurement Bioinformatics is also important as it enables measurement of biodiversity of an ecosystem. Biodiversity is all the genomes of all the different species of organisms and animals in an ecosystem. The animals and organisms’ names have therefore to be collected, including their descriptions, genetic information and distribution in a specific ecosystem. There are so many other important information about the organisms that have to be noted alongside the genetic information. These are such as habitat needs, species and population size (Barnes and Gray, 2003). All this information is stored in the databases and is collected for a reason. Several studies that require animal genomic constitution in an ecosystem do take place, therefore need an information source. Information technology has enabled formation of specialized programs of software which are used by the scientists and researchers to retrieve, analyze and share information about their research. This leads to more progress in the field of molecular biology. The importance of this is that it helps in the conservation of the ecosystem. For example, in an ecosystem, there are always those species that are endangered, this can easily be determined by this information technology system of biodiversity determination. Computer simulations has enabled modeling of conservation, population dynamics and calculation of a breeding pool’s genetic health (Barnes and Gray, 2003). Cancer Mutation Analysis Since bioinformatics has enabled storage of sequences of several genes and provided means through which analysis can be carried out, cancer mutations can be detected. Sequences of normal genes are stored in the databases. Determination of a cancer mutation is therefore not difficult as the normal sequence can be compared to the abnormal one and the area of difference marked. This has been used to find out point mutations and other types of mutations. As noted earlier, this is important in cancer therapy (Higgins and Taylor, 2000; (Lesk, 2005). Conclusion Bioinformatics has lead to enormous discoveries due to the provision of information about the genomes of different species, their characteristics and other biological information in the databases. The main issue here is the biological information, how to retrieve it, provision of analysis methods and provision of interpretation methods thereby assisting many studies in many areas. Application of information technology in molecular biology has enabled discoveries of therapies and genetic information about disease causing organisms. This application of information technology is very important as with the changes in the world, evolution is taking place and several different organisms are coming up. Some of these organisms can cause diseases to human and can be a threat if nothing is done about them. Since genome sequences, analysis methods and other important biological information are provided in the programs and databases, determination of the origin of such an organism can be easy and ways of treating it can also be established, therefore eliminating the threat to humans. If for example HIV mutates, like it does, and there are no effective ways of determining the mutation, it means the virus will kill so many people as the new strain has no way to be controlled. Bioinformatics is therefore very important in molecular biology. References Barnes, M. R. and Gray, I. C. (2003). Bioinformatics for Geneticists. US: Wiley. Baxevanis, A. D. and Ouellette, B. F. (2001). Bioinformatics: A Practical Guide to the Analysis of Genes and Proteins. US: Wiley-IEEE. Gibas, C. and Jambeck, P. (2001). Developing Bioinformatics Computer Skills. Oreilly Associates Inc. Higgins, D. and Taylor, W. (2000). Bioinformatics: Sequence, Structure, and Databanks : a Practical Approach. UK: Oxford University Press. Letovsky, S. (1999). Bioinformatics: Databases and Systems. US: Springer. Lesk, A. M. (2005). Introduction to Bioinformatics. UK: Oxford University Press, 2005 Westhead, R. D. , Parish, J. H. and Twyman, M. R. (2002). Bioinformatics. UK: BIOS, 2002 How to cite Bioinformatics, Papers